PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G054200.2
Common NameB456_009G054200, LOC105770299
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 698aa    MW: 76154.6 Da    PI: 5.7584
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G054200.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.95.5e-29205258155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv+av+qL G ekA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Gorai.009G054200.2 205 KPRVVWSVELHRKFVSAVNQL-GLEKAVPKKILDLMNVDGLTRENVASHLQKYRL 258
                         79*******************.********************************8 PP

2Response_reg82.91e-27261341109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl vdD+p+ +++l+++l+k +y +v+++ ++  al++l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah++ +++ + 
  Gorai.009G054200.2  26 VLAVDDDPICLKVLENLLRKCQY-HVTTTNQAITALKMLRENRnrYDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSAHSDTKLVMKG 114
                         799********************.***************999889*******************87754.558****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga d+l Kp+ +eel +
  Gorai.009G054200.2 115 ITHGACDYLLKPVRIEELKN 134
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363923.4E-1701697IPR017053Response regulator B-type, plant
SuperFamilySSF521726.26E-3623146IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23005.5E-4323166No hitNo description
SMARTSM004481.7E-3324136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.07425140IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.1E-2526134IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.73E-2827139No hitNo description
PROSITE profilePS5129412.392202261IPR017930Myb domain
SuperFamilySSF466898.6E-20202262IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-30203263IPR009057Homeodomain-like
TIGRFAMsTIGR015579.0E-25205258IPR006447Myb domain, plants
PfamPF002491.3E-7207257IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 698 aa     Download sequence    Send to blast
MTMEEKLGGS NGEDGGRDRF PIGMRVLAVD DDPICLKVLE NLLRKCQYHV TTTNQAITAL  60
KMLRENRNRY DLVISDVNMP DMDGFKLLEL VGLEMDLPVI MLSAHSDTKL VMKGITHGAC  120
DYLLKPVRIE ELKNIWQHVV RKKKPDSKDQ INASNQDKSR GGTGETGPTS SSSDQKVSKK  180
RKDQSEDEDE EGDDNGHEDP STQKKPRVVW SVELHRKFVS AVNQLGLEKA VPKKILDLMN  240
VDGLTRENVA SHLQKYRLYL KRLSSVATQQ ANMVAALGSK DPSYLRMGSL DGFGDFRTLT  300
GPGRISSASL SSYQPGGLFG RLNSSSALSL RGISSGVIQT GHSQTLNNPI NGFGKIQPAV  360
VPANQNQNGT LFQGIPTSIN QLSQNKPTNH FGEFNRGNDP NAFGVATNFQ DARVTVGGSS  420
NTLPVSSGNP LLLQSNTQQT QHSGAFGNQP SSLGVTSLNQ EPFDMNVRGS SNFLDHGRCS  480
ENWQSAVQLS SFPSNALSAS ETFSHEQLPS NNLQESISWT SSHLSSSPLD LSSSMANPAN  540
LEDSRGNISQ VGLNNNVIQN IDCTTKQQWG DSRHDYNGNM NNSFSRGDSL VPASGPMMDQ  600
SNVISDKMND VSLFSQFSGD STYVVPHLDG EKSAFGTKSR SNDDFLFETK PQNGFNQNSF  660
EPLENIMMSM IKSDQNNETP LMDGEFGFDA YSLGSCI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-26201264164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446887.10.0PREDICTED: two-component response regulator ARR12
TrEMBLA0A0D2Q9L20.0A0A0D2Q9L2_G
STRINGVIT_11s0206g00060.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-119response regulator 12
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]